Plant Transcription factor database - CTBE
version: 3.0

Zea mays Transcription Factor Database


>GRMZM2G123308_P02 [Zea mays]   protein sequence BLAST
MELFPSQPDLSLQIGLPASATPHDHHHGAALSARFLAAAAGGGGNGIPGNPAVAMAPSLQLPMPMPLPMPMPMPPNAAAA
AGAAGGLYYHPDAAAMLRPIRGVPLYQHPHTHAVPPTFPPHAAGAAGPCFCEPCHVAAGAWRRAGCGVGTRVVAGFPTAA
KRAARAPRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRTVKNTERPAASSDLADGFENG
SAGEICDDNSLDLHGAGRPESGAARHGRLAACNDHGSSTGAHGALWNSSSREDWTGFPSESNTGRMSMHSRSLKDQTMQS
KSLEILSDMNSSCVSETTSCASELNLEFTLGPRIRH