Plant Transcription factor database - CTBE
version: 3.0

Zea mays Transcription Factor Database


>GRMZM2G111448_P01 [Zea mays]   protein sequence BLAST
MYHQQQLHTHNQHLSSSRPGLPPEKQFLLHGAGGGGGGGDAGLVLSTDAKPRLKWTPELHERFVEAVHQLGGPDKATPKT
IMRLMGIPGLTLYHLKSHLQKYRLSKNLQAQAHTASAKNALVGCRTGADNALCQGSASPPPPPPPPHLNLEPPQINRSMH
ISEALQMQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQSVLEKAQEALAKQSGGADETTTTTQQQQQLLLPDLISRATATR
RGNVQQEHLHQQHHLGGDGSVDSCLTACEGSRCQRERDQDLLSIGLSSAPPPTPTPSRGYNDRGGGGSASCEEFLQFLDE
PSRRGAGGGGSSDEQQELDLSISGGRSNPRPRGSQSQRIDLNGSSWN