Plant Transcription factor database - CTBE
version: 3.0

Vitis vinifera Transcription Factor Database


>GSVIVP00034879001 [Vitis vinifera]  protein sequence BLAST
MLLPHPQQGMVEGPASFPIQVQEYRRPSIVLPSDLKPRLRWSPELHTLFVDAVNQLGGHEKATPKAIMKIMAVRGLTLYH
LKSHLQKIRMSKNIHHLLSCMNTAAFIFFTLRPCYS