Plant Transcription factor database - CTBE
version: 3.0

Selaginella moellendorffii Transcription Factor Database


>414222 [Selaginella moellendorffii]  fgenesh2_pg.C_scaffold_23000086 protein sequence BLAST
MARTGGAVRQYVRSKLPRLRWTPDLHHSFVSAVERLGGQERATPKLVLQLMDVKGLTIAHVKSHLQMYRSMKSDENFNVN
TQTDGESISDSQSPRAARFPGEFVLPDHDQSERSSLYNNSHLHPEPTVQGALLATTNRYSPSIRCDTSSGPCIAWPGDVS
DHGSGLCCFREWQGREFHVTDDALQAPELADGFRRRKRSCTRECPKDTVSQASEVRNGGHAAAGYENFHFLDINRSSSSR
SDDKRETRQLLLSGTLSEPTREIHGAERSNVLDFRISLPGLLEDDGKLVDSTLSLSLPNSSSTATSSFSRHQQFPERPSP
SPTASTCHWNQASAQRSSMAKPTFKLEHTSNRRPPNLDLTMAIGAG*