Plant Transcription factor database - CTBE
version: 3.0

Selaginella moellendorffii Transcription Factor Database


>405399 [Selaginella moellendorffii]  fgenesh2_pg.C_scaffold_3000622 protein sequence BLAST
MLYEALKQSTTKMSQHQRPSLPSPSPHHHQALSDPQRIASGSSPGATSSGGGGGASSNAVSNAAAAAAKQRLRWTPDLHE
RFVEAVGQLGGADRATPKGVLRVMGVQGLTIYHVKSHLQKYRLAKYIPDPMGDGKSDKRRHPDLPSLGGSVQINEALRMQ
MEVQKRLQEQLEVQRHLQLRIEAQGKYLQKIIDEQKKMSGGLDNQPGASPGSTQVFSSDITVQGSDLKYELTESVPGLMD
PPGGGGGGALPAITSALSALGSMAANNSLSRENSPASVPNPLGASYTLLNNNNNNIRTDDAVVVSPRHQESVEEYLHSKS
LQQQQQSYHHSSYLQCNTAGRLP*