Plant Transcription factor database - CTBE
version: 3.0

Selaginella moellendorffii Transcription Factor Database


>35907 [Selaginella moellendorffii]  gw1.41.229.1 protein sequence BLAST
ISASEPKPRLRWTPELHERFVEAVTQLGGAEKATPKSVMRIMGVKGLTLYHLKSHLQKFRLGKQLNKDTNVANRNACPHH
FASSQITEALRLQMEVQKKLHEQLEVQRHLQLRIEAQGKYLQALLEKARETFS