Plant Transcription factor database - CTBE
version: 3.0

Sorghum bicolor Transcription Factor Database


>5056233 [Sorghum bicolor]  Sb05g000480 protein sequence BLAST
MAGGSKGCDESSADHQLLLSSGQAGDDGEDDAGGADDVPPAGRHDGSSSNSSTVELDEAGGDSGRKVAGASPSSVRPYVR
SKNPRLRWTPELHLCFLRAVDRLGGQDRATPKLVLQLMDVKGLSIGHVKSHLQMYRSKKIDDSDQGATGSWRDLHHQLQD
GGQAYNLGHLSFHHGQTGASTILSARFGAWPHWSNFHDPSYLLHSHHLLGSKHYYSSTAEADVFLRNRAQYTARATSNTP
ASTTLQRCLNDQFMNHHQRRLSQNEDNIHHDPLDLELALDIGPSQDKRIKRSSGCSWRRHQEEENVGNQEVESATDDTRL
SLSLFPSPPYVRTSSGGHHKVLGLNMEKGTAHPTRTSTLDLTI*