Plant Transcription factor database - CTBE
version: 3.0

Sorghum bicolor Transcription Factor Database


>5048067 [Sorghum bicolor]  Sb01g007030 protein sequence BLAST
MLQRNLPNLCLQISPPAASSAVVASDAPVAASAKPPPTQPISTATYAEGSGEVGFFANPSPGAEPPGLSLGLATPALGDN
AAGRRGHHLQPQGCAFKRAAARASLPAAGSKRSARAPRMRWTTALHARFVHAVELLGGHERATPKSVMELMNVKDLTLAH
VKSHLQMYRTVKSTDRSLHTATGEALPLQRTAATGMEAAAAAAAGGGGGGAGGGVIMVPVPAACDDMVGICSSPSAGSAP
PAMATTSAAHFLCAPAATTAPLAAAPSPPPPIPPRSRTTDHAAAVPEKGVAIVDSLHRPVLEDTHQAAQEKANNGQLPMG
LHGCVDLLDPMATNCSSPASSSPSLASLEQLTADMYAPNLEISLGRQDWSMDRPEGLCLKYL*