Plant Transcription factor database - CTBE
version: 3.0

Sorghum bicolor Transcription Factor Database


>5011309 [Sorghum bicolor]  estExt_fgenesh1_pg.C_chr_102300 protein sequence BLAST
MRGFERKGVRQYNRSEVPRMRWTEELHRQFVEAVECLGGQDEATPKRILQLMGVKGVSISHIKSHLQMYRSSSSSSSSST
HQSSLQKLTSSTAASNSKRVFLSREDHCAYASQDGNTPAPSDKNIYTTMLRGCSHSSPYQIPPSLEEVFRSCWEQRRGRA
PWNSNVLTTEKAIRPGHTNNKKPAEKQHTGCDLTLSIGLWEDASSDDADGSSSISEELLLPAPAAGARRVAAAVKEEESK
PAALNLDLTISSSWLA*