Plant Transcription factor database - CTBE
version: 3.0

Sorghum bicolor Transcription Factor Database


>4999599 [Sorghum bicolor]  estExt_fgenesh1_pg.C_chr_21196 protein sequence BLAST
MEVCMSARLVGEWNLLSQMERLSTNQLYKSGVPVTIPTSLPSIPASLDESFPRLPDTQSVLMERELRSTPLPTHQTTVAP
IRGHFHSNTGSVGPLCSPPSVRFCSLSNPDQYSNHNPYNSQPPSTASSSTLNYGSQYGGFEPSITDFPRDVEPTWCPDPV
ESILGYSGDVPAGNNVTGTTSIGASDDLTKQTEWWTEFMNEDWKDMVDIPTSTETQQVGQPVQSSISVHQSATQQTVSSQ
SVEPLAVVAPSPTAGSNTAKARMRWTPELHERFVDAVNQLGGSEKATPKGVLKLMKADNLTIYHVKSHLQKYRTARYRPE
LSEGSSEKKAASKEDIPSIDLKGSFDLTEALRLQLELQKRLHEQLEIQRSLQLRIEEQGKCLQKMLEQQCIPGTEKAQDA
STTADELKLPSEIPESSTVKEVRENCQNGSTKQTGLNQVVFVLLWEQMNAIGNFFAKPGKVHVTRS*