Plant Transcription factor database - CTBE
version: 3.0

Sorghum bicolor Transcription Factor Database


>4995425 [Sorghum bicolor]  fgenesh1_pg.C_chr_10002602 protein sequence BLAST
MWTNLERLVIMESVNHLQAMNSQSLLAMEQIAASDKTAHVSALSVHKLFDAKLDHHSLMDGTSASTSQSSNIKTELIRSS
SLSRSLSVNLQKRSPESDPESPQSHVSHPKFSEPMFSNSSTFCTSLFSSSSTKTEPCHQMGTLPFLPHPPKCEQQVSAGQ
SSSSSLLLSGDTGNGLDEAEQSDDLKDFLDLSGDASDGSFQENNALAYDEQMEFQFLSEQLGIAITDNEKSPHLDDIYGT
PPQLSSLPISSCSTQSIQDLGSPVKVQLSSSQSSSSSATTNKSRLRWTLELHERFLEAVKKLEGPEKATPKGVLKLMKVE
GLTIYHVKSHLQKYRLAKYLPGPKEDKKASSEDKKAQTGKSGSDSSKNKNLQVAEALRMQIEVQKQLHEQLEVQRQLQLR
IEEHARYLQKILEEQKAGSLSLKAPTKAQATESPESTLDEVSTTPQPSRNRNPVVDTECKSPVDTECKSPARPSKNRIPV
VDTECKSPARIKRTKVQVDLENETLCS*