Plant Transcription factor database - CTBE
version: 3.0

Sorghum bicolor Transcription Factor Database


>4979951 [Sorghum bicolor]  fgenesh1_pg.C_chr_4002784 protein sequence BLAST
MGGAAGGGRNGAATRRYNRSKVPRLRWTSELHRNFVRAVDCLGGQDKATPKLILQLMGVRGLTIAHVKSHLQMYRSSGHD
IRKREMQPRLRHLKHSFTIDEGGPKEFICPPMKRAEAAGPEAAATATATHESMQGNSDMGAPGTRRCGDDYTRAIPMGSS
RRITEGLGGWQQWQRDAAARAATAASTLRELGFWVRGTEEPFKVRQLVASFISLSCPVALEKNSWLEVGQPEMEANKASD
AAMHEWCCCLLLVVAEECQKWLLRT*