Plant Transcription factor database - CTBE
version: 3.0

Populus trichocarpa Transcription Factor Database


>825087 [Populus trichocarpa]  estExt_fgenesh4_pg.C_LG_XVI0361 protein sequence BLAST
MASRLQPAAVEAGCQNQNISLERSPDSIMSRFESPASAFYATERYMRFPQYDCQVGNYFCSQYSNSYDSHVSSHQSSGAD
YINSGEQADHNFGLKSTLESVVKPQFSCHKSFDKSDKGLSSSSGNKLPSEHHNKFLDNPGVSLENHFLVPFQGNQNRQVD
YNPYNSPFSELGRFNSREEKRSPRFSLGGFPISSGKDLSTTLSSKTRIRWTQDLHKKFVECVNRLGGAEKATPKAILKLM
DSDGLTIFHVKSHLQKYRSARYMPDSSEGKAEKRTSIDDVSQLDVKTGFQIREALEVQLDVQRRLHEQLEIQKILQLRIE
EQGKQLKMMFDQQQKKTNSLLNNQNLNITSPDESTFSLEDIDVSIVEGSNNNTHFPSKIS*