Plant Transcription factor database - CTBE
version: 3.0

Populus trichocarpa Transcription Factor Database


>765696 [Populus trichocarpa]  fgenesh4_pg.C_LG_VIII000710 protein sequence BLAST
MFHTKKPSTMNSHDRPMCVQDSGLVLTTDPKPRLRWTVELHERFVDAVAQLGGPDKATPKTIMRVMGVKGLTLYHLKSHL
QKFRLGKQLHKEFNDHSIKDASALDLQRSAASSSGMISRSMNDNSHMIYAIRMQMEVQRRLHEQLEVQRHLQLRTEAQGK
YIQSLLEKACQTLAGDQDLASGSYKGIGNQGVPDMGAMKDFGPLNFPPFQDLNIYGSGQLDLLHNMDRPSLDGFMSNNHD
DICLGKKRTNPYAGSGKSPLIWSDDLRLQDLGSGLSCLGPQDDPLKGDQIQIAPPLMDSGTDLDSLSGLYGTKPVHQGDA
LDEKKLEASAKTERPSPRRAPLAADRMSPMINTGVMPQGRNSPFG*