Plant Transcription factor database - CTBE
version: 3.0

Populus trichocarpa Transcription Factor Database


>741543 [Populus trichocarpa]  estExt_Genewise1_v1.C_640538 protein sequence BLAST
MKVDWTPELHRRFVQAVEQLGVDKAVPSRILELMGIDCLTRHNIASHLQKYRSHQKHLLAREAEAASWSQRRQMYGTAAA
SGGGGKTDISAWHAPTMGFPPIIPMHHHFRPLHVWGHPSMDQSLMHMWPKHLAHSPYSPLPPPPTWH