Plant Transcription factor database - CTBE
version: 3.0

Populus trichocarpa Transcription Factor Database


>651036 [Populus trichocarpa]  grail3.0027002401 protein sequence BLAST
MELSLDLSLVYVPKAISECLKEVSMVKDGSQKLPNPDDYVKRLEDERRKIDAFKRELPLCMLLLNEAIIRLKEEAMQCKE
LNALVPLKGDSNEDGNDKKKWMSSVQLWNTNNNINLDCKNQDTRSEPKQRGEEDDDRSTCENPIQLGNHGNKGGAFVPFK
ALSGFERSKKKEEKEVVSQVTGLSLMKQQRQHAYRKQRRCWSPELHRCFVDALQQLGGYQVATPKQIRELMQVDGLTNDE
VKSHLQKYRLHLRKVPASSATPANDLWKSQDQCEDPVMHNISESNSPKAPLHGSSSAKAASNSGGDSMEAEDDDKSESHS
WNGVLHHPGEVHV*