Plant Transcription factor database - CTBE
version: 3.0

Populus trichocarpa Transcription Factor Database


>286787 [Populus trichocarpa]  gw1.40.547.1 protein sequence BLAST
MRSVSPFPDLSLQISPPSVEAKETGYDGGLTRKALCSDRSSTTDSGSSGSDLSHENGFLNQERSYNLGPSEPTLSLGFDM
ADLSSQTLQLPRNLNHHHHQPQIYGRNFKRSARMINGVKRSVRAPRMRWTTTLHAHFVHAVRLLGGHERATPKSVLELMN
VKDLTLAHVKSHLQMYRTVKSTDRGPGKLYCLSSGKADANNLPQPLNNPPPSPPPPPLSSTQKNQRSLGDEKNISSLEAL
TYVNVEAHDHSKRLDSSSSSSSDMLLNLEFTLGRPSWQLDYAETTNELTLLKC