Plant Transcription factor database - CTBE
version: 3.0

Populus trichocarpa Transcription Factor Database


>172570 [Populus trichocarpa]  gw1.I.1170.1 protein sequence BLAST
DDERIDVWEMGLPTPYDLTPLSQLLIPPELASAFNISPEPHRTPLDVNRASQNTLSNLHGHLNALSSNNFKSFNETTEAD
SALRTENWVDDPSSAAARTLKRPRLVWTPQLHKRFVDVVGHLGMKNAVPKTIMQWMNVEGLTRENVASHLQKYRLYLKRK
QGLSSEGPSASDQLFASTPVPQSLHE