Plant Transcription factor database - CTBE
version: 3.0

Physcomitrella patens Transcription Factor Database


>25200 [Physcomitrella patens]  gw1.27.80.1 protein sequence BLAST
DDDQVSDWTKGLPTSEELTPLSHTLISRILASAFRIKHEEPMTEEDVRRESQATIHNLFKQKPIPSFDAFPAFQEHDDAG
KVPESSYGGPREDESSRGGGSTDFGRKMADFELEDANSAGGLMNSNDEPLKRARLVWTPQLHKRFVEAVGHLGIKNAVPK
TIMQLMNVEGLTRENVASHLQKYRLYLKRMQGLSNDGPSASDHLFASMPLPP