Plant Transcription factor database - CTBE
version: 3.0

Physcomitrella patens Transcription Factor Database


>21269 [Physcomitrella patens]  gw1.47.44.1 protein sequence BLAST
TDPKPRLRWTPELHERFVDAVNQLGGADKATPKSVMRVMGVKGLTLYHLKSHLQKFRLGKQLQRDSHEANKDATYVCGIL
TGSSHLRGTSSDSKFSPANHQNPQEYYVNVNEALQLQMAAQIRLQEQLEVQKQLQQRIEAQGKYLQSILEKAKETLADHT
SASPVLKEVHEELTTLASKVIN