Plant Transcription factor database - CTBE
version: 3.0

Physcomitrella patens Transcription Factor Database


>168101 [Physcomitrella patens]  estExt_fgenesh1_pg.C_1660037 protein sequence BLAST
MRAAKVCHPLLGFAESREEGEEDEDGVDEASQTLGADRCRITGDHRLLLWSLKRLQEEIATLLSPVYATKLLFTVTAISV
SALADPHTFIQPHVQVPKRLDDCRVIRASRIVAKTGSTESEQPPDAVFAFSGGHSEGNVYSDSILFLFEELVGPLRSHKH
LTPTRMDFLGKQSFDGTEEDRDLDGGARTGASLRGSSDDLSSESNTTSTTNAQDPSSNVAKKLGSRGKVRQYVRSRLPRL
RWTADLHRCFVVAVERLGGQEKATPKMVLQLMDVKGLTIAHVKSHLQMYRSLKNDESVQSGNPTVASPSPTVDSRPPTQL
MKHLDGAGDAGIDSPSLRGDWHYLLETDFKKQQETDDDHFGQPFPGSVSRSLDSASNYNKIYNRFIGNAVNERSHDLFWP
KAQRPSKHITVDRYRYEHDDESNWRQDANSTEPDSLLSLSHLHSRPSLSTTSQKSIILNHRSTSVATEQVSFVDFLSSSQ
SRNTEQVATPADGLGLDLTMSTGSAIEDPEEVSLSFQRNKVEELDLMLDLTMSTR*