Plant Transcription factor database - CTBE
version: 3.0

Physcomitrella patens Transcription Factor Database


>166399 [Physcomitrella patens]  estExt_fgenesh1_pg.C_1140095 protein sequence BLAST
MQELSPDKSMSVSSSSNTHSGPDLALHISPPSSSSCDRRLKSSSQYSNLQVVPDHVHGFDLWKQPTKSMSCITDSESNVS
SPAAEGYSPAYVNSMGASTVLCLANPPLDSQYVKRALPKSTADEGMVIGRREEVQESVQENGYICKGLAHPFLLDNWSES
IRISPDRVSSPSDRIRKDLPRTFSIYPNETQENFTRRLSESSIDDLYSQQRVFSRPNYTSSHPSPIHELSLGRWSDPGVH
PEALPSRDLPKFQNYYMVGMDSCHRFSHQYGLENGKNMLGMQASTCGGNLSTLLGNYGAGYNAKREGVYANVTSFRSHFP
PRSPAKRSIRAPRMRWTSTLHAHFVQAVELLGGHERATPKSVLELMNVKDLTLAHVKSHLQMYRTVKTSDKSGPPSGSRD
PSPTSSLDSRLTTEELLMSDSMSQTGRSVHMSNSTMHNLELGNYRSLGDSQDATVSMQNRVWLPENPQNFNQAQRDAHAG
HCQLGNALTECFV*