Plant Transcription factor database - CTBE
version: 3.0

Oryza sativa subsp. japonica Transcription Factor Database


>LOC_Os09g23200.1 [Oryza sativa subsp. japonica] KANADI1, putative protein sequence BLAST
MAMVRELELMTSWSNSMGRHRYPTRILVDSFGHKCSASDKGVWTSCSIRAPLQGRGSFRRGANIRFGSLPSSAAVATSGG
GRGGGGVVVGGGGGDPWRRLDGSTASTELSLSPPPAQAAGGGGGGGGADALPWRHRPSPPSSAVATTSAAAAAALMAPMM
LQPLDAGGGASAPPPPIRGIPIYNGPGGFPFLQPSPTAGDVGHHHHHHPKMGFYSSYHHPSTWPSTSPSPLAAPPGAASS
PLDPTAAFLSSPHHRMLSAASGRLNGMLSVSDTLRSYGVPGAAAPGVIGGAHHHHHHLHGGQPFVGALASRFMPKLPAKR
SMRAPRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRTVKSTDKPAASSGPADGGSGDEE
FAGGGQAASGGGDSMCLRGGGGGGVAAAAFAEHGRSASEGAASSVGGGGGGDMDQSSAGNTSTTRWSNSSRDPWLSSNSC
NMDAHRSVGLSSPIENLEPCRSSSSQVSNHELSSPSLEFTLGRPDWHGADHD*