Plant Transcription factor database - CTBE
version: 3.0

Oryza sativa subsp. japonica Transcription Factor Database


>LOC_Os06g45890.1 [Oryza sativa subsp. japonica] MYB family transcription factor, putative, expressed protein sequence BLAST
MGGFERRGVRQYNRSEVPRMRWTEEMHRQFVEAVECLGGQDEATPKRILQLMGVKGVSISHIKSHLQMYRSGSSNSNHPV
SLQKLTSATVNNISKREFVNSEDRCIYASGDRNTASSDKNTYTILRCGRSSMPSIEEIFRNWEQTRGRLLPWNSNVITTE
QATTRASRQTTNYSKPLKQLTDCDLTLSIGQLWDDAAGSDADGSSTISEEVAAPSRDEAFVSSADDHFAAAAAKKESNML
TTDLNLDLTISSSWLS*