Plant Transcription factor database - CTBE
version: 3.0

Oryza sativa subsp. japonica Transcription Factor Database


>LOC_Os05g41240.1 [Oryza sativa subsp. japonica] Myb-like DNA-binding domain containing protein, putative, expressed protein sequence BLAST
MMYHAKKFSVPFGPQSTQSNEHMSNIGAFGGSNMGSPANPAGSGKQRLRWTSDLHNRFVDAIAQLGGPDRATPKGVLTVM
GVPGITIYHVKSHLQKYRLAKYIPESPAEGSKDEKKDSSDSLSNTDSAPGMQINEALKMQMEVQKRLHEQLEVQRQLQLR
IEAQGKYLQMIIEEQQKLGGSLKACEEQKLPHSPPSLDDYPDSMQPSPKKPKMDNLSPDSVRDVTQSDFESHLIGPWDQE
AAFRVDEFKADPGLNKS*