Plant Transcription factor database - CTBE
version: 3.0

Oryza sativa subsp. japonica Transcription Factor Database


>LOC_Os05g34110.1 [Oryza sativa subsp. japonica] homeodomain-related, putative, expressed protein sequence BLAST
MREEEEPSWFARWEEQLPAPDELMPLSQSLITPDLAVAFDIPTHGGGGGGGVGGGVVGGDGVGGGGGGGGGGGGGVGAGE
MNGGASSAAGSSGGGGGGGGGDEPARTLKRPRLVWTPQLHKRFVDAVAHLGIKNAVPKTIMQLMSVDGLTRENVASHLQK
YRLYLKRMQGVGNGGGGGGGGGAGAGGSHSSGSGTDAATEHLFATGPVPFLPPGRAPAGGDPYPPFAPMGGHHHHPPQIG
HFHHHPAARPLGHYGSGPGAGFDHGFLSRAVAGGGPPVGPPGMHHRMVGPAAGMAMMAPSPFAEELELGSRGGGGGGGRR
ELTLFPTTGDH*