Plant Transcription factor database - CTBE
version: 3.0

Oryza sativa subsp. indica Transcription Factor Database


>OsIBCD028465 [Oryza sativa subsp. indica] Chr09_1860,1518,,,1,1518, protein sequence BLAST
MAMVRELELMTSWSNSMGRHRYPTRILVDSFGHKCSASDKGVWTSCSIRAPLQGRGSFRRGANIRFGRYETTLHGGALGV
TLVCAYQATKQSFLFFSKNSKNLLLHLLHHDSFHRMSSISGVSIEITVAAAEVEKEVFDRSVDGGELGGDATGPVAAHQL
AEQRGGGDVGGRAWRRRGGGATPKSVLELMDVKDLTLAHVKSHLQMYRTVKSTDKPAASSGPADGGSGDEEFAGGGQAAS
GGGDSMCLRGGGGGGVAAAAFAEHGRSASEGAASSPFVGALASRFMPKLPAKRSMRAPRMRWTSTLHARFVHAVELLGGH
ERATPKSVLELMDVKDLTLAHVKSHLQMYRTVKSTDKPAASSGPADGGSGDEEFAGGGQAASGGGDSMCLRGGGGGGVAA
AAFAEHGRSASEGAASSVGGGGGGDMDQSSAGNTSTTRWSNSSRDPWLSSNSCNMDAHRSVGLSSPIENLEPCRSSSSQV
SNHELSSPSLEFTLGRPDWHGADHD