Plant Transcription factor database - CTBE
version: 3.0

Oryza sativa subsp. indica Transcription Factor Database


>OsIBCD024638 [Oryza sativa subsp. indica] Chr07_4182,1041,,,1,1041, protein sequence BLAST
MTGTEQMMYHQQQVQSDSQHLSSRPGLSPEKQFLLQGGADSSSGLVLSTDAKPRLKWTSELHERFVEAVNQLGGPDKATP
KTIMRLMGIPGLTLYHLKSHLQKYRLSKNLQSQANASRAQGVLGCSTTEIDKPCEGNGSPASHLDLETQTNSSSMHINEA
LQMQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQSVLEKAQEALGTIAVAETAATANASSSKRLQNEHTQLHYHQQQQQVG
DGSVDSCLTTCDCEGSHHSRSHGHRGEQDILSIGLPPFEPAAARSGKEHHYLLFPNEPSRRRSCSDERRREMSTLQASEL
DLSINGRSSSHSHRRENIDLNGAGWS