Plant Transcription factor database - CTBE
version: 3.0

Oryza sativa subsp. indica Transcription Factor Database


>OsIBCD023224 [Oryza sativa subsp. indica] Chr07_2030,1281,,,1,1281, protein sequence BLAST
MERISTNQLYNSGIPVTVPSPLPAIPATLDENIPRIPDGQNVPRERELRSTPMPPHQNQSTVAPLHGHFQSSTGSVGPLR
SSQAIRFSSVSSNEQYTNANPYNSQPPSSGSSSTLNYGSQYGGFEPSLTDFPRDAGPTWCPDPVDGLLGYTDDVPAGNNL
TENSSIAAGDELAKQSEWWNDFMNYDWKDIDNTACTETQPQVGPAAQSSVAVHQSAAQQSVSSQSGEPSAVAIPSPSGAS
NTSNSKTRMRWTPELHERFVDAVNLLGGSEKATPKGVLKLMKADNLTIYHVKSHLQKYRTARYRPELSEGSSEKKAASKE
DIPSIDLKGGNFDLTEALRLQLELQKRLHEQLEIQRSLQLRIEEQGKCLQMMLEQQCIPGTDKAVDASTSAEGTKPSSDL
PESSAVKDVPENSQNGIAKQTGMRIH