Plant Transcription factor database - CTBE
version: 3.0

Oryza sativa subsp. indica Transcription Factor Database


>OsIBCD018457 [Oryza sativa subsp. indica] Chr05_3874,675,,,1,675, protein sequence BLAST
MGSPANPAGSGKQRLRWTSDLHNRFVDAIAQLGGPDRATPKGVLTVMGVPGITIYHVKSHLQKYRLAKYIPESPAEGSKD
EKKDSSDSLSNTDSAPGMQINEALKMQMEVQKRLHEQLEVQRQLQLRIEAQGKYLQMIIEEQQKLGGSLKACEEQKLPHS
PPSLDDYPDSMQPSPKKPKMDNLSPDSVRDVTQSDFESHLIGPWDQEAAFRVDEFKADPGLNKS