Plant Transcription factor database - CTBE
version: 3.0

Oryza sativa subsp. indica Transcription Factor Database


>OsIBCD007525 [Oryza sativa subsp. indica] Chr02_4473,918,,,1,918, protein sequence BLAST
MGISGERKGAARQYNRSKVPRLRWTAELHRSFVRAIDCLGGQQKATPKLILQLMDVRGLTISHVKSHLQMYRGTRHGIGQ
NDMQPQLHLKQHSFGSDEQSPKEFMCPPIKRAKVGTEASGKYRCMEGSSDMRSSAPPAGTRYFIDDCMRLQEVSMDRRRS
DQHDAAAAARARAPAAAASSLHQALGFWVQGRREEPFMVHQISKPKAHQLNHMVRNMKISCKENHESRFFMVRSATRDEQ
VKKRAPPLSLAVDQKAANAISWPSEASCVISPSPRNFSTDCSGPPGCSFVGRRVNLELSLSICGS