Plant Transcription factor database - CTBE
version: 3.0

Ostreococcus lucimarinus Transcription Factor Database


>26838 [Ostreococcus lucimarinus]  eugene.1200010183 protein sequence BLAST
MTVYPAVYGAYDAMRAMSPMTYDAYAGAARAVAVPGDSFSRQIQERAYASAFTFTRQWNYLQHAAAAQHAAFASGSRGGG
TMMDLLAATGSAAAERDIGVEREVELSKRQRLVWTPQLHAQFIAAVQKLGVKTAVPKAIMKIMNVKGLTRENVASHLQKY
RLTLKRAQDSSESTRASGDATDAKRSDVRAGRKRKDREEKGKTNSGSGQGSGQGSDGGSAEHSASENLENRAKRISSSEE
EETRQITLAVDHNDE*