Plant Transcription factor database - CTBE
version: 3.0

Carica papaya Transcription Factor Database


>evm.TU.supercontig_120.29 [Carica papaya]   protein sequence BLAST
MEGSGGTQCSKTSHSNPNQGESSEQSEENDDVCNKLRNGGSSSNSTVEENEKKPMVRPYVRSKMPRLRWTPDLHLRFVHA
VERLGGQERATPKLVLQQMNIKGLSIAHVKSHLQMYRSKKMDEPGQAIADNKYLVESGDGNIYNLSQLPMLKGYNQSQGS
PFRYGESSWCNQESLTNTGSCSSWGFINAFRPGSLVAGRIYGGHNIISNNSPCSIGSSLSNSHCASQTHEQYHLSTYTKS
WQSEYKANQSDQLNQPQAKMEDCKSIKGFINGPSSLSGLNQYNTKENKTVKRKALACNLDLDLSLRLTPTSLININHGRS
RNLEVEDEDDNDLSLSLYSPSSVKLSRLKQGVEEQNEEMARRASTLDLTI