Plant Transcription factor database - CTBE
version: 3.0

Chlorella sp. NC64A Transcription Factor Database


>141785 [Chlorella sp. NC64A]  IGS.gm_38_00048 protein sequence BLAST
MPRRRAQRITEQAEPSTSSACPSSDAETLDEGRGADSGTTDEPLSQPAEPSSPAAPRCGGGTLRGRPRMLWSPELHKEFE
AAVHKLGGPFSATPKCILEMMGTKGLSLTNVKSHLQKFRLKAHKRAQLQAAEAEATAVAVAGSPRPTKAGRAGGGVASTG
SLPAGLSAAVLPNNMVPITTAGAVAAGQQGEVSFADPELAAQAAAWQRKRLGLVAAIQGALQACQSPTAHLSQHHEQAVV
QWQLENLHCLHVLHSLHMMQMRQHLAAAACLKEKAQQAAANAPLPPEALQLVT*