Plant Transcription factor database - CTBE
version: 3.0

Chlorella sp. NC64A Transcription Factor Database


>136336 [Chlorella sp. NC64A]  IGS.gm_16_00059 protein sequence BLAST
MALWGGGGADFWSSEQAGLSNPGQQDLDSFLQGLLSETVDLNAPLVPGPLAVSFGLSTDSSVSCLPPRAAVALGGRGAQG
VGVAAPSHARRRSGQQQAAAGGSGAATASKDQLVPALPGGPMASAGNGQQARQPLASPAAQQQQRAAAAARAAHSLRLDA
SGQQEQSGQPPASFSGLLTEQAAAAAAALAEAPQAAAGAAATEGGTADGGDGPSQPFGSADREQQAAAPPHLRYDFAQAQ
QDQAAVVAQFQQAQQAQQAQQAAAAALFAQQQAAYQQASYQQQQQAAYQQQQAAQAAQAAAGQGQGGGDPNSAAAFFQRQ
QQQAAAAAAAAFQFQNPYGAWGMYGPQYGQQYGQQYPNYYPPYGTNMQFQGMQFPGMQQQGGGQMGGGQMGGTSGMGFPP
MTGASGAGAGNPAAPPGVLPPAGPQLQQQLPGMTEVVQQSEGAAHGGAAAATVGLGGFDDDPCALKKARLIWTPALHRRF
LEAVNRVGGVDKALPKAVMKEMGVSGLTRENVASHLQKHRMRLKKEEEEGGGGVHTGHHTPAGSGRGVARVKHVDEDDIA
SMRQPGGRLPRAACR*