Plant Transcription factor database - CTBE
version: 3.0

Arabidopsis thaliana Transcription Factor Database


>AT5G42630.2 [Arabidopsis thaliana]  ATS/KAN4 (ABERRANT TESTA SHAPE)  protein sequence BLAST
MMMLESRNSMRASNSVPDLSLQISLPNYHAGKPLHGGDRSSTSSDSGSSLSDLSHENNFFNKPLLSLGFDHHHQRRSNMF
QPQIYGRDFKRSSSSMVGLKRSIRAPRMRWTSTLHAHFVHAVQLLGGHERATPKSVLELMNVKDLTLAHVKSHLQMYRTV
KCTDKGSPGEGKVEKEAEQRIEDNNNNEEADEGTDTNSPNSSSVQKTQRLLFIYIFIFVKFCI*