Plant Transcription factor database - CTBE
version: 3.0

Arabidopsis thaliana Transcription Factor Database


>AT5G18240.2 [Arabidopsis thaliana]  MYR1 (MYB-RELATED PROTEIN 1); transcription factor  protein sequence BLAST
MYYHNQHQGKSILSSSRMPISSERHPFLRGNGTGDSGLILSTDAKPRLKWTPDLHERFVEAVNQLGGGDKATPKTIMKVM
GIPGLTLYHLKSHLQKYRLSKNLNGQANSSLNKTSVMTMVEENPPEVDESHSESLSIGPQPSMNLPISDALQMQIEVQRR
LHEQLELRIEAQGKYLQSILEKAQETLGRQNLGAAGIEATKAQLSELVSKVSADYPDSSFLEPKELQNLHHQQMQKTYPP
NSSLDSCLTSSEGTQKAPKMLDNRLGLRTYIGDSTSEQKEIMEEPFFHRMELTWAEEESLRENHNRPYLSTMVNNAEPRI
SSSRRSPGRLSIGVGLHEHRGRSSNNSEYTEERFNENNEDCKLETHTRTALDLNTHDENYGTTRPKQFDLNGFSWN*