Plant Transcription factor database - CTBE
version: 3.0

Arabidopsis thaliana Transcription Factor Database


>AT3G25790.1 [Arabidopsis thaliana]  myb family transcription factor  protein sequence BLAST
MIKNLSNMKNDNQKREKCCEYIEALEEERRKINVFQRELPLCVELVTQAIEAYKREISGTSTDNLYGQSECSEQTTGECG
RILDLFIPIKHSSTSIEEEVDDKDDDDEEHQSHETDIDFDDKNMKSEWLKSVQLWNQSDAVVSNNRQDRSQEKTETLVEL
IKINDEAAKKNNNIKSPVTTSDGGSGGGGGRRGQRKNRRCWSQELHRRFLNALKQLGGPHVATPKQIRDIMKVDGLTNDE
VKSHLQKYRLHARRPSQTTPNNRNSQTQHFVVVGGIWVPQTNHSTANAVNAVASGETTGIYGPMVSSLPSEWPRHSNFGR
KISEDRSRCSNNGFFRCSSPAMSCSTRTKTKDAKIIS*