Plant Transcription factor database - CTBE
version: 3.0

Arabidopsis lyrata Transcription Factor Database


>908412 [Arabidopsis lyrata]  scaffold_600469.1 protein sequence BLAST
MREEDSNWFAKWEEELPSPEELIPLSQSLITPDLAIAFDLHRDNSNSGQPLPQTTPPQPNSSTEFAGDSTGDEPARTLKR
PRLVWTPQLHKRFVDAVAHLGIKNAVPKTIMQLMSVDGLTRENVASHLQKYRLYLKRMQSGGGGGGGGDSDHLFASSPVP
PHFLHQTSRQSSDLFIPSLVPISTQQQHIAAPPSQFLHRQMSAVNFTSPTKATDQAMFLARQQSQLQQPVFRPSSLHLHS
QVANYTQDLDSGAKTVLTLFPTRDD*