Plant Transcription factor database - CTBE
version: 3.0

Arabidopsis lyrata Transcription Factor Database


>899405 [Arabidopsis lyrata]  scaffold_303375.1 protein sequence BLAST
MVIFSFLFIFIFLPIILSTTLTRKQITPKEGKITPCIFYTSDEKARLRWSRDLHDCFVTAVEKLGGPDKATPKSVKETME
VEGIALHHVKSHLQNDLRLRRCREAQRMQTAFAIENQRNMFETQYLKASMNPTLPSQYNNNISTSTTLSQQSSSQEQWFI
PLSYHFSEGDTNPFTMNYSQQPSIIIPQNTTSVKDFCNDDMACLSLSELNQNTCNTFSIYEASIHPTQGNLQLNDNQSYD
MAQGFVNPYMSIESQSMHGLSTITTQQQLQVNNSCVIHDSYHNATFSSATVPPTINSLHQDTLNNTIVLSTTPQSIQASV
PHNQYPPYNTLEVVKAQLNALQDSSTNQTQETLSRGTTLSSSVTRDEVDPVDTYIDWDKVNERDIELDLVEIL*