Plant Transcription factor database - CTBE
version: 3.0

Arabidopsis lyrata Transcription Factor Database


>490936 [Arabidopsis lyrata]  fgenesh2_kg.7__369__AT4G37180.2 protein sequence BLAST
MGLNLNLSIYSLPKPLSQFLDQVSRIKDHHSKLSEIDGYVGKLEEERKKIDAFKRELPLCMLLLNEEIVFLCVAIEALNE
EARKGSSVMASNGKFDEREGAKPETDKKSWMSSAQLWISNPNSQLQSTNEEEDRCVSQNPFQTCNQGGAFLPFNRPPPPP
PPAPLSLMTPTSDMMMDCSRIEQNHHHHHQFNKPSSQSHHIQKKEQRRRWSQELHRKFVDALHRLGGPQVATPKQIRDLM
KVDGLTNDEVKSHLQKYRMHIRKHPLHPTKTLSSSDQPGVLSERESQSLISLSRSDSPQSPLVARGLFSSNVGHSSEEDE
EEDEEEEEKSDGRSSCRNDETKKKRQVLDLEL*