Plant Transcription factor database - CTBE
version: 3.0

Arabidopsis lyrata Transcription Factor Database


>475994 [Arabidopsis lyrata]  fgenesh2_kg.2__1124__AT1G68670.1 protein sequence BLAST
MVEMDYAKKMQKCHEYVEALEEEQKKIQVFQRELPLCLELVTQAIEACRKELSGTTTTSEQCSEQTTSVCGGPVFEEFIP
IKKRSLCEEQEEDGEHESSPELEQIGNNKKSDWLRSVQLWTPSPDLNPKEERVVKKAKVVEVKPKSGAFQPFQKEKKRVL
ETDLQPAVKVASSTPATTTSSTTETGGAKSELVKVGEEQRQIEQQQSQSQTHRKQRRCWSPELHRRFLNALQQLGGSHVA
TPKQIRDHMKVDGLTNDEVKSHLQKYRLHTRRPAATSVAAQSNGNPQQPQFVVVGGIWVPSPQDFPPPSDVANNGGVYAP
VAVAQSPKRSVERSCNSPAASSSTNTNTSTPVS*