Plant Transcription factor database - CTBE
version: 3.0

Arabidopsis lyrata Transcription Factor Database


>352378 [Arabidopsis lyrata]  fgenesh1_pg.C_scaffold_6002971 protein sequence BLAST
MKKPIVRSYIRSKVPPMRWTDDLDLLFTQVVELLGGERKATPKPILNCMDVRNLTISHVKSHLQMYRKKKKEEFIKERRM
MREMNQRQSRQYLQIYERARDATQFMQNQQRPQLDIIEKITPVLGSSNKFLYQFARERLNENRNNDVVVAGGSAIGEEEL
SLELTLGHKY*